Protein Info for CA264_15360 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 9 to 27 (19 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 79 to 101 (23 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 136 to 153 (18 residues), see Phobius details amino acids 159 to 175 (17 residues), see Phobius details amino acids 186 to 204 (19 residues), see Phobius details amino acids 216 to 238 (23 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details amino acids 273 to 291 (19 residues), see Phobius details PF00892: EamA" amino acids 11 to 151 (141 residues), 50.5 bits, see alignment E=1.2e-17 amino acids 159 to 290 (132 residues), 39.4 bits, see alignment E=3.2e-14

Best Hits

KEGG orthology group: K05786, chloramphenicol-sensitive protein RarD (inferred from 43% identity to fps:FP1609)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YV90 at UniProt or InterPro

Protein Sequence (315 amino acids)

>CA264_15360 permease (Pontibacter actiniarum KMM 6156, DSM 19842)
METTNTKPYYAAGLAAFVIWGFIPFPLKALAAYPSGQILYFRVALSAALLLLISLLFRRK
QLQATWRQLTSSSTRERRLFALFTFLGGALLTTNWLTFIYVVNHIDIQTGSFSYLLCPII
TAVLGFLLLKEELRVNQWLAIGLSALSCALVGSGEITSLLFSLLIALSYAFYLITQRILK
AYDKIVLLKLQLLLAFAFIGPFYTSFAGEGAALDSYFFLQVGLLSAGFTVLPLFLNLFAL
KELTSGTIGILMYINPILNFVMAFLYFGEHTTGTKIAAYLLIFVSVIIYNLHIKSRNKGG
DGLVIPPVGTTAVVK