Protein Info for CA264_15285 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: selenide, water dikinase SelD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 TIGR00476: selenide, water dikinase" amino acids 10 to 314 (305 residues), 441 bits, see alignment E=1.2e-136 PF00586: AIRS" amino acids 53 to 160 (108 residues), 90.1 bits, see alignment E=1.3e-29 PF02769: AIRS_C" amino acids 173 to 343 (171 residues), 82.8 bits, see alignment E=3.1e-27

Best Hits

Swiss-Prot: 63% identical to SELD_PHOLL: Selenide, water dikinase (selD) from Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)

KEGG orthology group: K01008, selenide, water dikinase [EC: 2.7.9.3] (inferred from 62% identity to pmr:PMI1497)

MetaCyc: 59% identical to selenide, water dikinase (Escherichia coli K-12 substr. MG1655)
Selenide, water dikinase. [EC: 2.7.9.3]

Predicted SEED Role

"Selenide,water dikinase (EC 2.7.9.3)" in subsystem Selenocysteine metabolism (EC 2.7.9.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.9.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YV23 at UniProt or InterPro

Protein Sequence (350 amino acids)

>CA264_15285 selenide, water dikinase SelD (Pontibacter actiniarum KMM 6156, DSM 19842)
MEDTSTENIRLTQYSHGAGCGCKISPKVLDAILHSDISYPEEKNLLVGNSSRDDAAVYDI
GNGRAVISTTDFFMPIVDDAYDFGRIASANAISDVYAMGGTPMMAIAVLGWPIDKLAPEV
AKRVIEGSRSICHEAGIPLAGGHSIDSPEPIFGLAVTGMVDIKNLKQNNTATAGCELYLT
KPLGVGILSTSQKKAILKPEHEQLAPQQMMQLNKIGAELGQLPQVKAMTDVTGFGLMGHL
SEMCEGSNLTAEIYFDKVPVIPEALEYLAQKAIPGGTLRNFDSYGHKLADLTPDQKHLLC
DPQTSGGLLVAVDPVGRDEVLEIFRKYNLQLEPLGVLKERQGEEKLIRVI