Protein Info for CA264_15275 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: pyridoxine 5'-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 TIGR00559: pyridoxine 5'-phosphate synthase" amino acids 3 to 237 (235 residues), 279.1 bits, see alignment E=1.6e-87 PF03740: PdxJ" amino acids 3 to 234 (232 residues), 309.6 bits, see alignment E=5.2e-97

Best Hits

Swiss-Prot: 70% identical to PDXJ_CYTH3: Pyridoxine 5'-phosphate synthase (pdxJ) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K03474, pyridoxine 5-phosphate synthase [EC: 2.6.99.2] (inferred from 70% identity to chu:CHU_3403)

Predicted SEED Role

"Pyridoxine 5'-phosphate synthase (EC 2.6.99.2)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 2.6.99.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.99.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YUW6 at UniProt or InterPro

Protein Sequence (237 amino acids)

>CA264_15275 pyridoxine 5'-phosphate synthase (Pontibacter actiniarum KMM 6156, DSM 19842)
MTKLSVNINKIATLRNARGGNRPNVVQAAKDCERFGAEGITVHPRPDERHIRYQDVYDLK
EVVTTEFNIEGNPTPDFLKLVKEVRPAQATLVPDAPDAITSNAGWDTIKHKDFLTDVIGE
LKELGIRTSIFVDPIVPMVEGAAAVNTDRIELYTEAYATNFLQNREEAVAPYLEAAIKAQ
EFGLGLNAGHDLDLDNLKYLHMTLPGLQEVSIGHALICDALYLGLENTIQLYLRQLK