Protein Info for CA264_15225 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: di-trans,poly-cis-decaprenylcistransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 TIGR00055: di-trans,poly-cis-decaprenylcistransferase" amino acids 10 to 237 (228 residues), 290.4 bits, see alignment E=4.2e-91 PF01255: Prenyltransf" amino acids 17 to 237 (221 residues), 289.9 bits, see alignment E=6.4e-91

Best Hits

Swiss-Prot: 58% identical to ISPT_CHLTE: Isoprenyl transferase (uppS) from Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)

KEGG orthology group: K00806, undecaprenyl diphosphate synthase [EC: 2.5.1.31] (inferred from 69% identity to sli:Slin_4433)

MetaCyc: 44% identical to (2Z,6E)-farnesyl diphosphate mono-trans,poly-cis-dodecaprenyl diphosphate synthase (Thermobifida fusca)
RXN-11487 [EC: 2.5.1.88]

Predicted SEED Role

"Undecaprenyl diphosphate synthase (EC 2.5.1.31)" (EC 2.5.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.31 or 2.5.1.88

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YY51 at UniProt or InterPro

Protein Sequence (245 amino acids)

>CA264_15225 di-trans,poly-cis-decaprenylcistransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKEKVDLGNLPRHIAVIMDGNGRWAKRRGGLRIFGHQNAIKAVRDTVEAAAELGIEYLTM
YAFSTENWSRPAEEVSALMTLLVSTIRKEAATLNKNNIRLQTIGNTSSLPKACQRELNEA
IEMTQHNSRMTLVLALSYSGRWDITQAVQRLANEVGQGNIAPDAIDESAVAGYLSTAGMP
DPELLIRTSGEMRISNFLLWQLAYTELYITELLWPDFRKEHLYEAIISYQGRERRFGKTS
EQIVK