Protein Info for CA264_15200 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13432: TPR_16" amino acids 27 to 80 (54 residues), 16.2 bits, see alignment 9.8e-06 amino acids 59 to 118 (60 residues), 25.8 bits, see alignment 1e-08 amino acids 169 to 229 (61 residues), 30.8 bits, see alignment E=2.7e-10 amino acids 280 to 325 (46 residues), 17.9 bits, see alignment 3e-06 amino acids 343 to 395 (53 residues), 17.8 bits, see alignment 3.1e-06 PF13181: TPR_8" amino acids 57 to 87 (31 residues), 14.4 bits, see alignment (E = 2.8e-05) amino acids 165 to 195 (31 residues), 15.7 bits, see alignment (E = 1.1e-05) amino acids 197 to 229 (33 residues), 23.5 bits, see alignment (E = 3.3e-08) amino acids 233 to 263 (31 residues), 14.4 bits, see alignment (E = 2.8e-05) amino acids 371 to 395 (25 residues), 13.4 bits, see alignment (E = 6e-05) PF07721: TPR_4" amino acids 92 to 114 (23 residues), 10.8 bits, see alignment (E = 0.00056) PF13414: TPR_11" amino acids 170 to 207 (38 residues), 35.7 bits, see alignment 4.4e-12 amino acids 204 to 242 (39 residues), 29 bits, see alignment 5.5e-10 PF00515: TPR_1" amino acids 197 to 230 (34 residues), 34.2 bits, see alignment (E = 1.3e-11) PF07719: TPR_2" amino acids 197 to 229 (33 residues), 27.6 bits, see alignment (E = 1.7e-09) PF13174: TPR_6" amino acids 199 to 229 (31 residues), 12.6 bits, see alignment (E = 0.00015) amino acids 237 to 259 (23 residues), 15 bits, see alignment (E = 2.6e-05) PF14559: TPR_19" amino acids 210 to 269 (60 residues), 36.8 bits, see alignment 3.3e-12 amino acids 278 to 329 (52 residues), 27.8 bits, see alignment 2e-09 amino acids 350 to 395 (46 residues), 32 bits, see alignment 1e-10 PF13431: TPR_17" amino acids 219 to 251 (33 residues), 29.4 bits, see alignment (E = 4.5e-10) PF13176: TPR_7" amino acids 374 to 395 (22 residues), 16.6 bits, see alignment (E = 5.3e-06)

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YUS5 at UniProt or InterPro

Protein Sequence (547 amino acids)

>CA264_15200 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MTHNWKYIALMAAAFPATAAFAQSGNAGRKAVDLERYEEAKSIYKSQLNNKNEADNAYFA
LGDIYLRTDKPDSAAYYFNQGISANKKSYINHVGLGKVALHQGDQAKAEQQFEEALKGKG
KKDPYVLAMIGEAYVNAPNATEAQINKGIDYLKQSLERDNKNAVANVILGDAYLQLKKGG
EAMTNYDRAIQLDEQYATAYLKRGQLYTSSRNYPEAEQAFQRAIEIDPNFAPAYRDLGEL
YYFAGQYDKALSTFQKYVDLAEDTPETKAKYASFLFLTKNYEQALQTAEQVLQKEPDNTV
MNRLRAYSYLELGQPQKALEAIQTYMQKTDPSKLIAQDYEYYGRILGKNDQPAKAIENME
KALQMNDANIELYADLANMYARNNQYDKAIEVYKRKRKNVEPSNADYYYMGNIYMMAGEE
NATSGNAQKANEFFTQADSTYAQVAKANPDYAYAYLWRARANASQDPETEKGLAKPYYEE
FIAKASSEPEKYKKDLIEANSYLGYYYYLKGERDNAVKYWTAVKTLDPSNPQADAALKEI
AKAPKKK