Protein Info for CA264_15165 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: flagellar motor protein MotA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 184 to 211 (28 residues), see Phobius details amino acids 231 to 252 (22 residues), see Phobius details PF01618: MotA_ExbB" amino acids 148 to 264 (117 residues), 101.9 bits, see alignment E=1.1e-33

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 60% identity to psn:Pedsa_2967)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YUQ8 at UniProt or InterPro

Protein Sequence (288 amino acids)

>CA264_15165 flagellar motor protein MotA (Pontibacter actiniarum KMM 6156, DSM 19842)
MEKKTAVVSKNANVEPKNSPVGSVFASIVIPIALIACVLIYLFVLGNPANFEGGNTENHP
LPGNYLGVVYKGGWVVPVLMSLNLMVFIFAIERALTIGKAKGTKNVAQFVRSISAKLNQR
DINGAIASCDAQKGSVGNVVKAGLLKYKEMQNEPELLKAEKVAAIQKEIEESTALELPML
EKNLVVISTIASISTLVGLIGTVLGMIKAFAALATSGSPDSVALANGISEALINTALGIT
GSTIAIIAYNYFTSKIDELTYSIDEAGFSMVSTFTAQHETPAARPQTV