Protein Info for CA264_15145 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: phosphoglucosamine mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03990: phosphoglucosamine mutase
  • amino acids 4 to 453 (450 residues), 529.6 bits, E=3.4e-163
• PF02878: PGM_PMM_I
  • amino acids 8 to 140 (133 residues), 107.1 bits, E=1.2e-34
• PF02879: PGM_PMM_II
  • amino acids 171 to 262 (92 residues), 79.1 bits, E=6.5e-26
• PF02880: PGM_PMM_III
  • amino acids 269 to 374 (106 residues), 71.6 bits, E=1.2e-23
• PF00408: PGM_PMM_IV
  • amino acids 390 to 455 (66 residues), 39.6 bits, E=9.1e-14

Best Hits

Swiss-Prot: 31% identical to GLMM_METKA: Probable phosphoglucosamine mutase (glmM) from Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)

KEGG orthology group: K01840, phosphomannomutase [EC: 5.4.2.8] (inferred from 73% identity to sli:Slin_2856)

Predicted SEED Role

"Phosphomannomutase (EC 5.4.2.8) / Phosphoglucosamine mutase (EC 5.4.2.10)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis or Alginate metabolism or Mannose Metabolism (EC 5.4.2.10, EC 5.4.2.8)

MetaCyc Pathways

• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• glycogen degradation I (7/8 steps found)
• colanic acid building blocks biosynthesis (9/11 steps found)
• glycogen degradation II (5/6 steps found)
• GDP-mannose biosynthesis (3/4 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (3/4 steps found)
• starch degradation V (3/4 steps found)
• O-antigen building blocks biosynthesis (E. coli) (8/11 steps found)
• β-1,4-D-mannosyl-N-acetyl-D-glucosamine degradation (2/3 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-glucose biosynthesis (1/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (6/9 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis I (3/5 steps found)
• glucose and glucose-1-phosphate degradation (3/5 steps found)
• superpathway of anaerobic sucrose degradation (13/19 steps found)
• sucrose biosynthesis II (5/8 steps found)
• starch degradation III (2/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (2/4 steps found)
• chitin biosynthesis (5/9 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (2/5 steps found)
• glucosylglycerol biosynthesis (2/5 steps found)
• sucrose degradation II (sucrose synthase) (2/5 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (4/8 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (8/14 steps found)
• starch biosynthesis (5/10 steps found)
• β-(1,4)-mannan degradation (2/7 steps found)
• peptidoglycan recycling I (7/14 steps found)
• CMP-legionaminate biosynthesis I (3/10 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (7/19 steps found)
• streptomycin biosynthesis (3/18 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (6/24 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (10/33 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Fructose and mannose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.8

Use Curated BLAST to search for 5.4.2.10 or 5.4.2.8

Sequence Analysis Tools

See A0A1X9YUQ4 at UniProt or InterPro

Protein Sequence (463 amino acids)

>CA264_15145 phosphoglucosamine mutase (Pontibacter actiniarum KMM 6156, DSM 19842)
MALIKSISGIRGTIGGQAGDGLTPVDVVKFSAAFGTWVLQNTDKKIIVVGRDARLSGDMV
NKLVCATLQGLGIDVIDLGLSTTPTVEMAVPEKKAGGGIILTASHNPKQWNALKLLNHKG
EFISDEEGKLVLEIAEKEAFEFAQVNDLGKYKQSESALKKHIKAVLALPLVDVEAIKARN
FSVVVDAVNSSGGFAVPMLLEALGVNKIEKLFCEPDGNFAHNPEPLPENLREISKVIEKG
KFDLGIVVDPDVDRLALVNEDGSMFGEEYTLVAVADYVLKHQKGNTVSNLSSTRALRDVT
EKAGGAYYAAAVGEVNVVNMMKEQHAIIGGEGNGGIIYPELHYGRDALVGIALFLTHLAK
SGMSMTRLRASYPNYYISKNKIELTPEVNVDEVLRQMKERYAKQPINTIDGVKIEFDKEW
VHLRKSNTEPIIRIYAESDSNATAEHLANKIIADIKEIISVKA