Protein Info for CA264_15140 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: cysteine desulfurase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 PF00266: Aminotran_5" amino acids 3 to 366 (364 residues), 256 bits, see alignment E=8.6e-80 PF01212: Beta_elim_lyase" amino acids 48 to 176 (129 residues), 35.2 bits, see alignment E=1.3e-12 PF00155: Aminotran_1_2" amino acids 49 to 292 (244 residues), 27.5 bits, see alignment E=2.8e-10

Best Hits

Swiss-Prot: 41% identical to ISCS1_BACSU: Putative cysteine desulfurase IscS 1 (iscS1) from Bacillus subtilis (strain 168)

KEGG orthology group: K04487, cysteine desulfurase [EC: 2.8.1.7] (inferred from 65% identity to dfe:Dfer_4416)

Predicted SEED Role

"Cysteine desulfurase (EC 2.8.1.7)" in subsystem Alanine biosynthesis (EC 2.8.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.7

Use Curated BLAST to search for 2.8.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YUT1 at UniProt or InterPro

Protein Sequence (380 amino acids)

>CA264_15140 cysteine desulfurase (Pontibacter actiniarum KMM 6156, DSM 19842)
MRVYLDNAATTPLDKEVFDAMAPFMLEHFGNPSSIHSHGREVRAAIERARKTVAGLLNTS
PAEVFFTSGGTEADNAALICTCRSLGIKHAISTKLEHHAVLHTLELLERQEGVQVSYLRH
DELGNLDLEHLEELLANQPQTLVSIMHANNEIGNLNDVAAIGEICRKYNAVFHSDTVQTM
GHYVHDVQQLGANFIVGSAHKFHGPKGVGFLYCDGATKIQPLIQGGAQERNMRGGTENVY
GIIGLAKALEIAYRDMEEHTRYIQGLKDRMIHKLREQMDDVSFNGLSEFGDKSLYTVLNV
NLPASDINEMLLFSLDIAKISASGGSACSSGANTGSHVLRALNVDPTRGSVRFSFSKYNT
PEEIDYAAETLAKMYKKQLA