Protein Info for CA264_15130 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ferrochelatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 52% identical to HEMH_PARUW: Ferrochelatase (hemH) from Protochlamydia amoebophila (strain UWE25)

KEGG orthology group: K01772, ferrochelatase [EC: 4.99.1.1] (inferred from 65% identity to mtt:Ftrac_2597)

Predicted SEED Role

"Ferrochelatase, protoheme ferro-lyase (EC 4.99.1.1)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.99.1.1)

MetaCyc Pathways

superpathway of heme b biosynthesis from glutamate (10/10 steps found)
superpathway of heme b biosynthesis from glycine (7/8 steps found)
heme b biosynthesis I (aerobic) (4/4 steps found)
heme b biosynthesis II (oxygen-independent) (3/4 steps found)
heme b biosynthesis V (aerobic) (3/4 steps found)
superpathway of heme b biosynthesis from uroporphyrinogen-III (4/6 steps found)

KEGG Metabolic Maps

Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.99.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YUX0 at UniProt or InterPro

Protein Sequence (342 amino acids)

>CA264_15130 ferrochelatase (Pontibacter actiniarum KMM 6156, DSM 19842)
MSNNKTGKIGVLLVNLGTPDTPQTPDVRKYLREFLLDKRVIDINPLGRYALVNGVIAPFR
APKSAKIYQQLWTERGSPLLYHGLDLKQKLQASLGDAYHVAFGMRYQKPSIKSALEELRE
KSVRRIIVFPLFPQYASATTGSVHDKIMEIVKDWWIIPSMNFISSYCNDPGFIGAFAELG
KKYMAEDNYDHVVFSYHGVPERQILKGSDHGYCKLGSCCNSYNKRNQYCYRASCFETSRQ
LAKALGLQDDQYTVAFQSRLGKDPWLQPYTDDVLKTMPAKGIKKVLAFSPAFVADCLETT
VEVGEEFKEMFEHAGGERWQLVESLNSNDAWVEAMKQLVLQH