Protein Info for CA264_15125 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: GTPase Era

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 TIGR00231: small GTP-binding protein domain" amino acids 9 to 163 (155 residues), 88.5 bits, see alignment E=4.1e-29 TIGR00436: GTP-binding protein Era" amino acids 9 to 276 (268 residues), 274.2 bits, see alignment E=1.1e-85 PF01926: MMR_HSR1" amino acids 11 to 123 (113 residues), 90 bits, see alignment E=5.1e-29 PF02421: FeoB_N" amino acids 11 to 164 (154 residues), 49.4 bits, see alignment E=1.7e-16 PF10662: PduV-EutP" amino acids 13 to 166 (154 residues), 35.8 bits, see alignment E=3e-12 PF00071: Ras" amino acids 13 to 168 (156 residues), 23.5 bits, see alignment E=1.7e-08 PF00009: GTP_EFTU" amino acids 36 to 171 (136 residues), 37.6 bits, see alignment E=8e-13 PF07650: KH_2" amino acids 206 to 282 (77 residues), 63.5 bits, see alignment E=5.7e-21

Best Hits

Swiss-Prot: 57% identical to ERA_AMOA5: GTPase Era (era) from Amoebophilus asiaticus (strain 5a2)

KEGG orthology group: K03595, GTP-binding protein Era (inferred from 68% identity to sli:Slin_5225)

Predicted SEED Role

"GTP-binding protein Era" in subsystem Bacterial Cell Division or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YUY1 at UniProt or InterPro

Protein Sequence (296 amino acids)

>CA264_15125 GTPase Era (Pontibacter actiniarum KMM 6156, DSM 19842)
MAETPHKAGFVSIVGKPNVGKSTLMNALVGEKLSIITSKAQTTRHRIMGILNGDDFQIVY
SDTPGIIKPQYALHESMMGFVRTSLEDADVILFVTDIYEKHDEEDVIKRLQHAKVPVLLL
INKIDQATEEEVNEKVAYWQEHMNPTEILPISALHNFGLDQLFARLLHYLPQHPPYFPKD
ELTDKPERFFVSEMIREKIFLNYKKEIPYSCEVVVEEFKEEEDIIRIRAEISVERRSQKG
IVIGNKGEALKKVGTQARLDMEEFFQKKIFLDLYVRVNENWRTDQKLLRRFGYREE