Protein Info for CA264_15080 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: N-acetylmuramic acid 6-phosphate etherase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 TIGR00274: N-acetylmuramic acid 6-phosphate etherase" amino acids 3 to 255 (253 residues), 326.8 bits, see alignment E=5.1e-102 PF13580: SIS_2" amino acids 36 to 156 (121 residues), 28.2 bits, see alignment E=1.7e-10 PF01380: SIS" amino acids 120 to 205 (86 residues), 25.7 bits, see alignment E=8.6e-10

Best Hits

Swiss-Prot: 67% identical to MURQ_GRAFK: N-acetylmuramic acid 6-phosphate etherase (murQ) from Gramella forsetii (strain KT0803)

KEGG orthology group: K07106, N-acetylmuramic acid 6-phosphate etherase [EC: 4.2.-.-] (inferred from 73% identity to sli:Slin_5916)

MetaCyc: 53% identical to N-acetylmuramic acid 6-phosphate etherase (Escherichia coli K-12 substr. MG1655)
RXN0-4641 [EC: 4.2.1.126]

Predicted SEED Role

"N-acetylmuramic acid 6-phosphate etherase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.-.- or 4.2.1.126

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YUW3 at UniProt or InterPro

Protein Sequence (274 amino acids)

>CA264_15080 N-acetylmuramic acid 6-phosphate etherase (Pontibacter actiniarum KMM 6156, DSM 19842)
MSTTESASNYDGLDKMSVRELLENINREDKTVPLAVEKAIPQIEKLVNATVERLQQGGRL
FYIGAGTSGRLGIVDASECPPTYGVPHGMVVGIMAGGDVAIRKAVEFAEDDPEQAWKDLQ
EHNINEKDIVVGIAASGRTPYVIGGLNACRERGIATGCVVCNAGSAVAAAAEFPVEVVTG
PEFVTGSTRMKAGTGQKLALNMLTTSTMIKLGRVKGNKMVDMQLSNHKLVDRGTRMVMEE
LEIGREEAGALLQKYGSVRAAVDAFRNGNEHQVL