Protein Info for CA264_15035 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02771: Acyl-CoA_dh_N
  • amino acids 32 to 144 (113 residues), 105.4 bits, E=5.8e-34
• PF02770: Acyl-CoA_dh_M
  • amino acids 148 to 241 (94 residues), 86 bits, E=4.1e-28
• PF00441: Acyl-CoA_dh_1
  • amino acids 253 to 415 (163 residues), 109.5 bits, E=4.3e-35
• PF08028: Acyl-CoA_dh_2
  • amino acids 270 to 409 (140 residues), 51.5 bits, E=3.2e-17
• PF21263: Acyl-CoA-dh_C
  • amino acids 465 to 568 (104 residues), 108.8 bits, E=3.5e-35

Best Hits

KEGG orthology group: K00257, [EC: 1.3.99.-] (inferred from 72% identity to chu:CHU_3589)

Predicted SEED Role

"Butyryl-CoA dehydrogenase (EC 1.3.99.2)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases or Butanol Biosynthesis or Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Valine degradation (EC 1.3.99.2)

MetaCyc Pathways

• pyruvate fermentation to butanol II (engineered) (5/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Brassinosteroid biosynthesis
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid metabolism
• Geraniol degradation
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.2

Use Curated BLAST to search for 1.3.99.- or 1.3.99.2

Sequence Analysis Tools

See A0A1X9YUR1 at UniProt or InterPro

Protein Sequence (596 amino acids)

>CA264_15035 acyl-CoA dehydrogenase (Pontibacter actiniarum KMM 6156, DSM 19842)
MEKSTQNATIQGGEFLIKETNPQDVFIPAEFNEEQLMMAQTCKDFVREEVSPLLERLDNH
EEGLMENLMKKAGELGLFAVSAPEQYGGLNMDFNTSLLVTESVGGGHSFPVAFAAHTGIG
TLPILYFGTEEQKQKYIPKLVSGEWMSAYCLTEPGSGSDALAAKTKAVLNEAGTHYILNG
QKMWITNAGFADVFVVFAQIDGDKFTGFIVERGFKGVSLGNEEHKMGIRGSSTRQVFFED
CEVPKENVLGEIGKGHLIAFNILNIGRIKLGAATLGAAKKVADLSVKYANERHQFKLPIA
KFGAIKYKLAEQAIRIYAVESAIYRAGMDIYRKEQELMAGGANENEALLGAAREFAVECA
MLKVEGSEVLDYVADEGVQIYGGYGFSADYPMDRAYRDSRINRIFEGTNEINRMLTVDMI
LKKAMKGELDLMGPAQAVQQELMAIPDFGEEEEGLFTAEHKAIKNLKKAILMVAGTAVQK
YMNSLAKEQEILMNIADMAIKTYVAESTLLRVEKQVGMKGEEAVSNEIDIVRVVVNDAVD
TSFKAGKEAIAAMAEGDEQRLLFMGLKRFTKKDLFNAKEARRRIAATLIEANEYVY