Protein Info for CA264_15005 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: magnesium/cobalt efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 46 to 70 (25 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details TIGR03520: gliding motility-associated protein GldE" amino acids 2 to 406 (405 residues), 499.5 bits, see alignment E=4.1e-154 PF01595: CNNM" amino acids 2 to 163 (162 residues), 103.5 bits, see alignment E=1.7e-33 PF00571: CBS" amino acids 190 to 246 (57 residues), 21.8 bits, see alignment 3e-08 amino acids 260 to 309 (50 residues), 31.5 bits, see alignment 2.7e-11 PF03471: CorC_HlyC" amino acids 326 to 405 (80 residues), 63.3 bits, see alignment E=2.6e-21

Best Hits

KEGG orthology group: None (inferred from 40% identity to fte:Fluta_0184)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YYB2 at UniProt or InterPro

Protein Sequence (417 amino acids)

>CA264_15005 magnesium/cobalt efflux protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MLLSALTSGAEAAFFSLSEQELEQCKTSKRPAEQRVYRLLQNPRQLLTTILIVNNGINVT
IITLFAYVAWQVFGSMTLPASVMVLCMLFATFFIVFCGEVLPKVYVQKRRLRLVGHMAGL
LDRLQLLIRPLSWLLISINEHIEKKYIARGYTHTMEDLHHSLDVALINADTSPEERKILR
GVVNFGAINVKQIMRPRVDIIAFNTAKTLPELMPEIVKWGYSRVPVYTESTDQIEGILYV
KDLLPHLGKGAGFNWQQLVRPPFFVPEGKRIADLFQDFKEKHVHMAVVVNEYGGTVGLLT
LEDIVEEIVGEINDEFDDDDDIIYSQLDENTFIFDGKTSLHDFCKIAEVPFDAFDEVKGE
NETVAGLMLALFSRIPRVGEDAAYGRFHFTVESADTKRVKRVKINVASKKEQYHKAS