Protein Info for CA264_15000 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: single-stranded DNA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00621: single-stranded DNA-binding protein
  • amino acids 2 to 159 (158 residues), 173 bits, E=3.4e-55
• PF00436: SSB
  • amino acids 4 to 107 (104 residues), 134.5 bits, E=7.1e-44

Best Hits

Swiss-Prot: 53% identical to SSB_RALSO: Single-stranded DNA-binding protein (ssb) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03111, single-strand DNA-binding protein (inferred from 58% identity to mtt:Ftrac_2590)

Predicted SEED Role

"Single-stranded DNA-binding protein" in subsystem DNA repair, bacterial or DNA repair, bacterial RecFOR pathway or pVir Plasmid of Campylobacter

Sequence Analysis Tools

See A0A1X9YUW4 at UniProt or InterPro

Protein Sequence (159 amino acids)

>CA264_15000 single-stranded DNA-binding protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MASVNKVILIGNLGKDPEVRHLEGGVAVARFPIATSETFKDKQGQRQERTEWHNIVLWRG
LAEVAEKYLKKGNSVYIEGRLRTNNYQDKDGIQRYSTEIVADQMTMLGGRNDNGNGGGGN
YQESAASSGSNYGAGAAAGSGNSGGASAFQNDEPDDLPF