Protein Info for CA264_15000 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: single-stranded DNA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 TIGR00621: single-stranded DNA-binding protein" amino acids 2 to 159 (158 residues), 173 bits, see alignment E=3.4e-55 PF00436: SSB" amino acids 4 to 107 (104 residues), 134.5 bits, see alignment E=7.1e-44

Best Hits

Swiss-Prot: 53% identical to SSB_RALSO: Single-stranded DNA-binding protein (ssb) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03111, single-strand DNA-binding protein (inferred from 58% identity to mtt:Ftrac_2590)

Predicted SEED Role

"Single-stranded DNA-binding protein" in subsystem DNA repair, bacterial or DNA repair, bacterial RecFOR pathway or pVir Plasmid of Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YUW4 at UniProt or InterPro

Protein Sequence (159 amino acids)

>CA264_15000 single-stranded DNA-binding protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MASVNKVILIGNLGKDPEVRHLEGGVAVARFPIATSETFKDKQGQRQERTEWHNIVLWRG
LAEVAEKYLKKGNSVYIEGRLRTNNYQDKDGIQRYSTEIVADQMTMLGGRNDNGNGGGGN
YQESAASSGSNYGAGAAAGSGNSGGASAFQNDEPDDLPF