Protein Info for CA264_14915 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 50 to 72 (23 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 148 to 170 (23 residues), see Phobius details amino acids 175 to 199 (25 residues), see Phobius details amino acids 231 to 256 (26 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details amino acids 298 to 315 (18 residues), see Phobius details amino acids 320 to 342 (23 residues), see Phobius details amino acids 381 to 403 (23 residues), see Phobius details PF05977: MFS_3" amino acids 9 to 406 (398 residues), 121.1 bits, see alignment E=5e-39 PF07690: MFS_1" amino acids 25 to 285 (261 residues), 69.7 bits, see alignment E=2.3e-23

Best Hits

KEGG orthology group: None (inferred from 54% identity to chu:CHU_2160)

Predicted SEED Role

"MFS permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YUZ3 at UniProt or InterPro

Protein Sequence (419 amino acids)

>CA264_14915 MFS transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MSKTRKHDPYAVLKLPDFRLYVSARLCITLAMQIQAVIVGWQIYDMTQDPLSLGLIGLAE
AIPSIVVSLYAGYVADIVERKRIILVVVAVLALCSASLLYFTLDISRVLLLYGALPIYGV
IFVSGIARGFMGPAIFSFMPQLVPNKQLYANAITWSTTTWQAASVAGPAIGGLLYGFYGI
TASYMTDAVLVLLALLFFSMISRKPLPENANPQNLKESLQSGIRFVFGNQIILSAISLDL
FAVLFGGAVALLPIFASDILLVGPQGLGMLRAAPAVGSVLMAMLMAYYPINVDAGKKMLW
CVAGFGVCMVLFGLSRNFWFSLVLLALSGAFDSISMIIRSTLIHTLTPEYMKGRVSSVNN
IFVGSSNEIGAFESGFTAKLMGTVPAVVFGGIMTLVVVAFTSVKADKLRVLDLTPEEAV