Protein Info for CA264_14890 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: triose-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00121: TIM
  • amino acids 4 to 252 (249 residues), 319.7 bits, E=6.7e-100
• TIGR00419: triose-phosphate isomerase
  • amino acids 5 to 243 (239 residues), 205.5 bits, E=5e-65

Best Hits

Swiss-Prot: 60% identical to TPIS_CYTH3: Triosephosphate isomerase (tpiA) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K01803, triosephosphate isomerase (TIM) [EC: 5.3.1.1] (inferred from 64% identity to mtt:Ftrac_2600)

MetaCyc: 47% identical to triosephosphate isomerase subunit (Lactobacillus delbrueckii bulgaricus)
Triose-phosphate isomerase. [EC: 5.3.1.1]

Predicted SEED Role

"Triosephosphate isomerase (EC 5.3.1.1)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or MLST (EC 5.3.1.1)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• homolactic fermentation (11/12 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• gluconeogenesis I (11/13 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• glycolysis IV (8/10 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• gluconeogenesis III (9/12 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (12/17 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• glycerol degradation to butanol (11/16 steps found)
• superpathway of anaerobic sucrose degradation (13/19 steps found)
• glycolysis VI (from fructose) (7/11 steps found)
• ethene biosynthesis V (engineered) (17/25 steps found)
• glycolysis V (Pyrococcus) (6/10 steps found)
• sucrose degradation V (sucrose α-glucosidase) (2/5 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)
• oxygenic photosynthesis (10/17 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (11/19 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (16/26 steps found)
• superpathway of N-acetylneuraminate degradation (11/22 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (20/56 steps found)

KEGG Metabolic Maps

• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Inositol phosphate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.1

Sequence Analysis Tools

See A0A1X9YUQ3 at UniProt or InterPro

Protein Sequence (253 amino acids)

>CA264_14890 triose-phosphate isomerase (Pontibacter actiniarum KMM 6156, DSM 19842)
MRKKIVAGNWKMNKTAEEALSLVSEIDNMVKDEVNGDVTVVVAPPFPFLQSVGKLTQGND
KMHLAAQNVSEHDSGAFTGEVSAAMLKSVGVEYVIIGHSERRLYHHEDAQTLYKKMKAAI
AQGLKPIFCCGEPLEERDADRHFDYVGKQLHDSLSYLSNEEFDQVVVAYEPIWAIGTGRT
ASSQQAQEMHEYIREQLARMFDAEAAYKTPILYGGSCNPANAQELFAQADVDGGLIGGAS
LKSRDFTDVIKSF