Protein Info for CA264_14880 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: 50S ribosomal protein L11 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06325: PrmA
  • amino acids 35 to 272 (238 residues), 172.2 bits, E=7.3e-54
• PF01209: Ubie_methyltran
  • amino acids 104 to 235 (132 residues), 23 bits, E=1.9e-08
• PF05175: MTS
  • amino acids 126 to 212 (87 residues), 40.7 bits, E=8.1e-14
• PF01135: PCMT
  • amino acids 132 to 211 (80 residues), 28.6 bits, E=4.7e-10
• PF13489: Methyltransf_23
  • amino acids 135 to 250 (116 residues), 35.7 bits, E=2.8e-12
• PF13847: Methyltransf_31
  • amino acids 138 to 230 (93 residues), 44.9 bits, E=4.3e-15
• PF13649: Methyltransf_25
  • amino acids 143 to 233 (91 residues), 40.1 bits, E=2e-13
• PF08241: Methyltransf_11
  • amino acids 144 to 236 (93 residues), 28.6 bits, E=7.3e-10

Best Hits

Swiss-Prot: 46% identical to PRMA_BACFR: Ribosomal protein L11 methyltransferase (prmA) from Bacteroides fragilis (strain YCH46)

KEGG orthology group: K02687, ribosomal protein L11 methyltransferase [EC: 2.1.1.-] (inferred from 50% identity to sli:Slin_5617)

Predicted SEED Role

"Ribosomal protein L11 methyltransferase (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended or Ribosome biogenesis bacterial (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See A0A1X9YUM4 at UniProt or InterPro

Protein Sequence (275 amino acids)

>CA264_14880 50S ribosomal protein L11 methyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MDFIEVTLTVNTDFADILTAELGELGFDAFVETENGFSAYIEEDKYNQQDLEETLSRYAD
FVEVTYAVQKIERQNWNEEWERNFEPLFIGGEVSVRASFHEKPAAAKYDIVINPKMSFGT
GHHETTTLMIENQLTLDHQGKRVLDMGCGTGILAIMAGELGATEIVAVEIEDWTVENARE
NAELNNYASIDVRLGGAETIEGEKPFDIILANINRNVLLEDMPAYKAVLKPEGWLLLSGF
YTEDLPMLQERAQELGLTYLSHRVKNNWVSALFKA