Protein Info for CA264_14770 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: antibiotic ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 612 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details amino acids 196 to 214 (19 residues), see Phobius details amino acids 283 to 303 (21 residues), see Phobius details amino acids 315 to 336 (22 residues), see Phobius details PF00664: ABC_membrane" amino acids 75 to 327 (253 residues), 139 bits, see alignment E=2.5e-44 PF00005: ABC_tran" amino acids 390 to 539 (150 residues), 112.7 bits, see alignment E=2.3e-36

Best Hits

KEGG orthology group: None (inferred from 54% identity to aas:Aasi_0351)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YUI5 at UniProt or InterPro

Protein Sequence (612 amino acids)

>CA264_14770 antibiotic ABC transporter ATP-binding protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MKTYLRILQFAKPYSRFVPLYTIYTFLGIIFGLFNFTLIIPLLNVLFGEVGQKEAVVMAA
TKPEFALNIEFFKEFFNYYFGQIILQEGREGALLFVCVMVIISVFLANLFRYLAFRIVGA
LRAHVVRNMRHTVYQRVTELHLGYFSNERKGDLMTRLTVDIQEVESSVVSTLTVVVREPI
SIIAFFILLFNMSVELTLFSLILLPLSGGIIAGISKRLKRKAKEGQNSLSFILTIIDETL
SGMRVVKAFNAEPFILSKFQDQNSRYARIQRSIANKRDLASPLSEFLGVSVVAGLLLYGG
TLVLNQESDLSASEFITYIILFSQVLVPAKAMSAAFSNIQRGLVSGDRVLQVIDTKPQIV
NKPNAKVLPAFKEEIEFRNVSFAYGDKPVLQDINIHIKKGTTVALVGPSGGGKSTMADLL
PRFYDPTGGAILLDGHDIRDYTMESVRAQMGVVTQESILFNDTIFNNIAFNKTEATEEEV
IAAAKIANAHEFIINTEAGYQTMIGDRGGKLSGGQRQRLSIARAILQNPPILILDEATSA
LDTESEKLVQEALNNLMKNRTSVVIAHRLSTIQHADQILVLQQGRVVERGTHDELLENSG
LYAKLTQMQLTV