Protein Info for CA264_14760 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: uracil phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF14681: UPRTase
  • amino acids 15 to 215 (201 residues), 144.4 bits, E=3.4e-46
• PF00156: Pribosyltran
  • amino acids 72 to 176 (105 residues), 45.8 bits, E=4.2e-16

Best Hits

Swiss-Prot: 48% identical to UPP_PORGI: Uracil phosphoribosyltransferase (upp) from Porphyromonas gingivalis (strain ATCC BAA-308 / W83)

KEGG orthology group: K00761, uracil phosphoribosyltransferase [EC: 2.4.2.9] (inferred from 59% identity to sli:Slin_5853)

Predicted SEED Role

"Uracil phosphoribosyltransferase (EC 2.4.2.9)" in subsystem De Novo Pyrimidine Synthesis or LMPTP YwlE cluster (EC 2.4.2.9)

MetaCyc Pathways

• superpathway of pyrimidine ribonucleosides salvage (9/10 steps found)
• superpathway of pyrimidine nucleobases salvage (4/4 steps found)
• pyrimidine nucleobases salvage II (2/2 steps found)
• pyrimidine nucleobases salvage I (1/1 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.9

Use Curated BLAST to search for 2.4.2.9

Sequence Analysis Tools

See A0A1X9YUN7 at UniProt or InterPro

Protein Sequence (218 amino acids)

>CA264_14760 uracil phosphoribosyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MENNNIHILTNTPSLANHYVAELRNVQVHGDSMRFRRNLERLGELLAYEISKTLPYKEET
IITPLSQTNTLLLTEQPVLATILRAGLPLYQGMLNYFDKAYSTFVGAYRVEEENTQLQIN
MEYLASTNLHDKILILADPMLATGRSLVRSYEGMLRHGKPKQVHFAAAIAAPEGLAYVRE
QVPEAHVWLGALDDHLNEKSYIVPGLGDAGDLAFGPKV