Protein Info for CA264_14745 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: DEAD/DEAH box helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 PF00270: DEAD" amino acids 34 to 199 (166 residues), 163.4 bits, see alignment E=6.3e-52 PF04851: ResIII" amino acids 52 to 195 (144 residues), 34.2 bits, see alignment E=3.7e-12 PF00271: Helicase_C" amino acids 237 to 346 (110 residues), 102.9 bits, see alignment E=1.8e-33

Best Hits

KEGG orthology group: K11927, ATP-dependent RNA helicase RhlE [EC: 3.6.4.13] (inferred from 65% identity to dfe:Dfer_4097)

Predicted SEED Role

"ATP-dependent RNA helicase RhlE" in subsystem ATP-dependent RNA helicases, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.13

Use Curated BLAST to search for 3.6.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YUL1 at UniProt or InterPro

Protein Sequence (453 amino acids)

>CA264_14745 DEAD/DEAH box helicase (Pontibacter actiniarum KMM 6156, DSM 19842)
MAEEAEKEITTFEDFKLNKQLLNAIADAGYEKPTPIQLQAIPLIMAGHDILGIAQTGTGK
TAAFLLPLLMKVKYAQGQHPRALIIAPTRELVMQIEENITLLAKYTDLRHTAIYGGLGPK
TQIEILNKGIDILVATPKRLMELYFKGELVLKDLKTLILDEADKMMDMGFMPQIRQLLEV
IPRKRQNLLFSATMPNKVVELSEEFLEFPTRVEITPQATPVETVSQTLYKVPNLRTKIEL
LEHLIQDEETFKRVIIFTRSKKNAESVSKFLEHRDYGDVRAIHGNKGQNTRINSMEAFKG
GEVRFLVATDVAARGIDVTMVSHVINFDVPLIYEDYVHRIGRTGRAENEGAAITFATDAE
LYHVQKIEKIIRMQIPQVPMPASVKLFKTPFEEQQEMAREVDRQKRRENPDFKGAFHEKQ
GKHKSNFAKGKKSKGDPKDSYWQKTKKKGSRKK