Protein Info for CA264_14690 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: peptidase S41

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 549 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR00225: C-terminal processing peptidase" amino acids 59 to 348 (290 residues), 285.4 bits, see alignment E=2.9e-89 PF13180: PDZ_2" amino acids 94 to 174 (81 residues), 36.4 bits, see alignment E=1.3e-12 PF00595: PDZ" amino acids 104 to 161 (58 residues), 32.1 bits, see alignment 3.2e-11 PF17820: PDZ_6" amino acids 112 to 162 (51 residues), 47.9 bits, see alignment 2.4e-16 PF14685: Tricorn_PDZ" amino acids 113 to 172 (60 residues), 26.2 bits, see alignment 1.7e-09 PF03572: Peptidase_S41" amino acids 194 to 348 (155 residues), 164 bits, see alignment E=5.8e-52

Best Hits

KEGG orthology group: K03797, carboxyl-terminal processing protease [EC: 3.4.21.102] (inferred from 56% identity to sli:Slin_3923)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.102

Use Curated BLAST to search for 3.4.21.102

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YUN0 at UniProt or InterPro

Protein Sequence (549 amino acids)

>CA264_14690 peptidase S41 (Pontibacter actiniarum KMM 6156, DSM 19842)
MYKKSIAGLFVGVFALGLFSFKTDSERYFEIAKNLDVFATLFKEVNTYYVDDVPPAQMMR
TGIDAMLKSLDPYTNYIPEDDIEDFRTMTTGQYGGIGAIIGARDGKVMVQMPYENSPAHK
AGLAIGDEILKVNGVNVQGKSSEEVSKLLKGQANTAIKLEVRSYGQAKSRNVELMRENIV
VDNVPYYGMLDSEIGYFQLSGFTMDAGKEVRTAVQKLKEMGAKKIVFDLRDNPGGLLHEA
VNISNVFVDKGTDIVSTKGKVEEWNKTYKALDEPLDKNMPLVILTSSRSASASEIVAGVM
QDYDRAVLVGERTFGKGLVQVTRPLSYNSQLKVTTAKYYIPSGRCIQAIDYTHRNEDGSV
GKIPDSLRVAFKTAAGRVVYDGGGVSPDVEVKQTGFSEITRTIAGKGYFYDYANQYKLEH
PSIPAAKEFQLTDQEYKKFVAYLANKDVSYTTGIENELKDVAETAKEGKHYDDIKAELEA
IKQKVSHNKANDLMRFREEIQEVLEAEIASRYYLQKGYIESSFDDDPDILMAKQVLNDPV
KYNAYLKAN