Protein Info for CA264_14620 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: CDP-diacylglycerol--serine O-phosphatidyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01066: CDP-OH_P_transf
  • amino acids 4 to 170 (167 residues), 71.9 bits, E=3.9e-24
• TIGR00473: CDP-diacylglycerol-serine O-phosphatidyltransferase
  • amino acids 10 to 177 (168 residues), 111.8 bits, E=1.7e-36

Best Hits

KEGG orthology group: K00998, phosphatidylserine synthase [EC: 2.7.8.8] (inferred from 54% identity to phe:Phep_3071)

Predicted SEED Role

"CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.8)

MetaCyc Pathways

• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• phosphatidylserine and phosphatidylethanolamine biosynthesis I (2/2 steps found)
• cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (2/4 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (8/13 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism
• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.8

Sequence Analysis Tools

See A0A1X9YUG4 at UniProt or InterPro

Protein Sequence (235 amino acids)

>CA264_14620 CDP-diacylglycerol--serine O-phosphatidyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKKHIPNVITCLNLLSGCLALYFAFKGELVTAAYLVGIAAIFDFMDGMIARLIGAYSEIG
KQLDSLADMVSFGVVPGTIMFMLLQRIEAPFWGIPADVVPFAGFLITIFSALRLAKFNID
TRQTTSFIGLPTPACTLFVASLPLILETGDLIMFEIILNQPVLLVLTVMLSFLLVAELPL
FALKFKNFTWQDNSIRFIFLGLSVILVAMLKFAAIPLIIVLYVLLSIIKKTSHTS