Protein Info for CA264_14595 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: sodium-independent anion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 513 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 45 to 62 (18 residues), see Phobius details amino acids 68 to 85 (18 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 152 to 175 (24 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 234 to 256 (23 residues), see Phobius details amino acids 277 to 297 (21 residues), see Phobius details amino acids 305 to 326 (22 residues), see Phobius details amino acids 333 to 352 (20 residues), see Phobius details amino acids 364 to 396 (33 residues), see Phobius details PF00916: Sulfate_transp" amino acids 19 to 366 (348 residues), 182.8 bits, see alignment E=9.2e-58 PF01740: STAS" amino acids 411 to 491 (81 residues), 29.8 bits, see alignment E=4.4e-11

Best Hits

KEGG orthology group: None (inferred from 79% identity to phe:Phep_2681)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YYC5 at UniProt or InterPro

Protein Sequence (513 amino acids)

>CA264_14595 sodium-independent anion transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MKQYLRLFDFSQKVDYKVEVLAGLTVAMTMIPESLSFAILAGFPPLVGLYAAFIMGLVTA
VLGGRPGMISGGAGATAVVLIALMQSHGLEYVFAAVALAGVLQILVGLFKLGKFIRLVPQ
PVMYGFVNGLAVIIFMSQVGQFQTEVNGQLVWLSGSSLYTMAGLVALTIAIIVLLPKVTK
AVPPSLVAIIVVFLVVLGFNIDTKTVADIAAVSGGLPPFHVPAVPFTLETLEVIFPYALI
MAGVGLTESLLTLNLVDEITGTRGQGNRESMAQGSANLLNGFFFGMGGCAMIAQTLVNLS
AGARARLAGIVAAFTILVIILVGAPVIELVPMAALVGVMIMVAVGTFEWISFRIINKMPK
QDVFVGILVAVITIWLHNLALAVLIGVIISALVFAWESAKRIRARKYIDANGVKHYEIFG
PLFFGSVTAFSEKFDVLNDPEEVVVDFKESRVADMSGIDALNKLTERYQNAGKKLHLKHL
SEDCRILLKNAEEVIDVNIMEDPHYAVATDKLA