Protein Info for CA264_14590 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: phosphoribosylformylglycinamidine synthase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01737: phosphoribosylformylglycinamidine synthase I
  • amino acids 1 to 226 (226 residues), 295 bits, E=1.6e-92
• PF13507: GATase_5
  • amino acids 4 to 210 (207 residues), 135.3 bits, E=2.1e-43
• PF07685: GATase_3
  • amino acids 32 to 95 (64 residues), 33.9 bits, E=2.5e-12

Best Hits

Swiss-Prot: 55% identical to PURQ_ANAVT: Phosphoribosylformylglycinamidine synthase subunit PurQ (purQ) from Anabaena variabilis (strain ATCC 29413 / PCC 7937)

KEGG orthology group: K01952, phosphoribosylformylglycinamidine synthase [EC: 6.3.5.3] (inferred from 68% identity to sli:Slin_6348)

MetaCyc: 52% identical to phosphoribosylformylglycinamidine synthetase subunit I (Bacillus subtilis subtilis 168)
Phosphoribosylformylglycinamidine synthase. [EC: 6.3.5.3]

Predicted SEED Role

"Phosphoribosylformylglycinamidine synthase, glutamine amidotransferase subunit (EC 6.3.5.3)" in subsystem De Novo Purine Biosynthesis (EC 6.3.5.3)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (5/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (4/5 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.3

Use Curated BLAST to search for 6.3.5.3

Sequence Analysis Tools

See A0A1X9YUJ0 at UniProt or InterPro

Protein Sequence (230 amino acids)

>CA264_14590 phosphoribosylformylglycinamidine synthase I (Pontibacter actiniarum KMM 6156, DSM 19842)
MKFGVVVFPGSNCDQDLVDAISVGMGQECIKLWHKDHDLQGCDFILLPGGFSYGDYLRSG
AISRFSPIMQEVVQHANKGGYVMGICNGFQILTEAGLLPGALLRNANQKFICDNVYIKPA
TTNLLPTRLLDMDKAYKIPVAHGEGRYHADKETLKRLEDNEQIMFKYSSNVADTHEIYNI
NGSLLNIAGVSNEQKNVFGMMPHPERAVDPELGNTDGRAIFESILNLVNA