Protein Info for CA264_14555 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: glycine cleavage system protein H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00527: glycine cleavage system H protein
  • amino acids 3 to 124 (122 residues), 167.4 bits, E=7.7e-54
• PF01597: GCV_H
  • amino acids 7 to 124 (118 residues), 150.4 bits, E=1.1e-48

Best Hits

Swiss-Prot: 63% identical to GCSH_GRAFK: Glycine cleavage system H protein (gcvH) from Gramella forsetii (strain KT0803)

KEGG orthology group: K02437, glycine cleavage system H protein (inferred from 70% identity to rbi:RB2501_03610)

MetaCyc: 47% identical to glycine cleavage system H-protein (Synechocystis sp. PCC 6803)
GCVMULTI-RXN [EC: 1.4.1.27]

Predicted SEED Role

"Glycine cleavage system H protein" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle)

MetaCyc Pathways

• folate transformations III (E. coli) (8/9 steps found)
• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• glycine degradation (3/3 steps found)
• folate transformations II (plants) (8/11 steps found)
• photorespiration II (5/10 steps found)
• folate transformations I (7/13 steps found)
• photorespiration I (4/9 steps found)
• photorespiration III (4/9 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (4/9 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.27

Sequence Analysis Tools

See A0A1X9YUJ2 at UniProt or InterPro

Protein Sequence (126 amino acids)

>CA264_14555 glycine cleavage system protein H (Pontibacter actiniarum KMM 6156, DSM 19842)
MNLPENLKYTKDHEWVRIEGDTAIIGITDFAQSELGDIVYVDIDTVDKQINQEDVFGTVE
AVKTVSDLFSPLSGTVLEFNEQLENSPELVNSDPYGDGWIIKMSIDDASQVDGLLTAEGY
REVIGQ