Protein Info for CA264_14545 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: Holliday junction branch migration protein RuvA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 PF01330: RuvA_N" amino acids 1 to 61 (61 residues), 87.4 bits, see alignment E=8e-29 TIGR00084: Holliday junction DNA helicase RuvA" amino acids 1 to 194 (194 residues), 163.4 bits, see alignment E=2.2e-52 PF14520: HHH_5" amino acids 71 to 129 (59 residues), 63.1 bits, see alignment E=4.1e-21 PF07499: RuvA_C" amino acids 150 to 195 (46 residues), 42.3 bits, see alignment 1.2e-14

Best Hits

Swiss-Prot: 60% identical to RUVA_CYTH3: Holliday junction ATP-dependent DNA helicase RuvA (ruvA) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K03550, holliday junction DNA helicase RuvA (inferred from 60% identity to chu:CHU_0028)

Predicted SEED Role

"Holliday junction DNA helicase RuvA" in subsystem DNA-replication or RuvABC plus a hypothetical

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YUK4 at UniProt or InterPro

Protein Sequence (196 amino acids)

>CA264_14545 Holliday junction branch migration protein RuvA (Pontibacter actiniarum KMM 6156, DSM 19842)
MIAYIDGKLTHKDPTYVIIEANGVGYQIRISLSTYSSLPAGERCKLQTYLHIKEDAHTLY
GFTTAAEKDAFLHLISISGVGPNTGLMILSSLSVEEVQHAIIREDVRTIQQVKGIGAKTA
QRIILELKDKMKKEALVSDVTIPAASHNTNRAEALSALVTLGFAKNVAEKTLDSIIKREG
GNLSVEELIKFALKSS