Protein Info for CA264_14535 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: lytic transglycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01464: SLT
  • amino acids 129 to 236 (108 residues), 106.2 bits, E=7.8e-35
• PF01476: LysM
  • amino acids 391 to 432 (42 residues), 52.9 bits, 2.9e-18
  • amino acids 463 to 505 (43 residues), 58.9 bits, 3.9e-20

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase D precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Glycosaminoglycan degradation
• Nucleotide sugars metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

See A0A1X9YUI3 at UniProt or InterPro

Protein Sequence (506 amino acids)

>CA264_14535 lytic transglycosylase (Pontibacter actiniarum KMM 6156, DSM 19842)
MTYSKFFTLLAAMAGSIWTSDASALGHSRLLDAPTKDSLALAAADPVKLQQTDTTTVSVL
TPEELALLVEVIPNEPNDVIADRLSCIESDIPLVFNDYVRNFIDYFTIRNRKYTRTMLTR
ENVYFPLFEKYLKKHNMPDELKYLAIVESGLNPLAQSPVGAAGLWQFMKPTGREYGLHQT
QYIDERLDPEKSTEAAMRFLRRLHNYYGDWELALAAYNCGQGNVNKAIRRAGGGKKTFWE
IFPYLPRETRGYVPSMTAVQYAMNYAGEHNIFSDSILYQPEVAYLEVMQALDLEKLAEEL
HLDPKELMALNPELKKTNLPDHMRNYKLRIPASRSALLATADDKSCIMLAAAPVVPHTKD
PEPETPVMFASAKTEQAAEKKEAPAVAKVTYTVQPGDNLTQIAKRHDVTVEQLKEWNNLK
SSSLMPKQELLVMQQAEAGAVLALNTKGKPEAKSAVEKKELIYHVQPGDTLWNISKKYNG
ISVEQIKKLNRLRSNEIKPGQKLILS