Protein Info for CA264_14505 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 PF14559: TPR_19" amino acids 51 to 115 (65 residues), 34 bits, see alignment E=2.3e-11 amino acids 118 to 172 (55 residues), 26.9 bits, see alignment 3.8e-09 PF13432: TPR_16" amino acids 80 to 139 (60 residues), 22.5 bits, see alignment 1e-07 amino acids 145 to 206 (62 residues), 27 bits, see alignment E=3.8e-09 amino acids 214 to 268 (55 residues), 23.9 bits, see alignment 3.6e-08 amino acids 496 to 548 (53 residues), 27.9 bits, see alignment 2e-09 PF13181: TPR_8" amino acids 107 to 133 (27 residues), 12.5 bits, see alignment (E = 0.00011) amino acids 141 to 165 (25 residues), 12.6 bits, see alignment (E = 0.0001) amino acids 212 to 240 (29 residues), 12 bits, see alignment (E = 0.00015) amino acids 423 to 453 (31 residues), 19.8 bits, see alignment (E = 5.1e-07) amino acids 495 to 519 (25 residues), 14.6 bits, see alignment (E = 2.2e-05) PF13174: TPR_6" amino acids 109 to 139 (31 residues), 19.6 bits, see alignment (E = 8.3e-07) amino acids 143 to 170 (28 residues), 15.1 bits, see alignment (E = 2.3e-05) amino acids 424 to 452 (29 residues), 14.6 bits, see alignment (E = 3.2e-05) amino acids 496 to 516 (21 residues), 12.6 bits, see alignment (E = 0.00014) PF13176: TPR_7" amino acids 143 to 165 (23 residues), 18.1 bits, see alignment (E = 1.7e-06) PF13428: TPR_14" amino acids 214 to 250 (37 residues), 23.9 bits, see alignment 3.6e-08 PF12895: ANAPC3" amino acids 470 to 543 (74 residues), 30.6 bits, see alignment E=2.4e-10

Best Hits

KEGG orthology group: None (inferred from 42% identity to dfe:Dfer_3772)

Predicted SEED Role

"FIG00898077: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YYS0 at UniProt or InterPro

Protein Sequence (569 amino acids)

>CA264_14505 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MIGTGESKAQSAKKKAKAAQEAPAPQVQQPSEHERQISEALFLDGMKYFMLEDYQQALQL
FQKAYTITPGNAALNYKIGETYLHLSEPRSAMPFAQAAATLDKRNAYYYLLLAQLHSEQK
QYDAAAQAFNDLIRNVPGSDEYLFNLADLYLSQSQYDNALRTYERIEKEFGDMEQLHVNR
QQIYLRQKNVDKAIAEGEKLLKSNPTEISYFLSQAELYNASQRPDEAISTLNRALRLEPG
NPFAHLMLSDLNRQKGQHTESEKQVKLAFASPELDIDTKVRILVDFIRQLPNPQIEGVAL
ELVDLTIATHPEEAKAYAVAADLQTIVGKKEIARNNYLKAVKLDDSHFKIWQQIVLLDAE
LEQPDEMVKHAEQALELFPNQAVFWFYSGTGHLIEKNYDKAVKALEYGKRLSAGEPELVK
QFNLQLGDSYNSLKDYKKSDAAYEEVLAQDPDNEHVLNNYSYFLSLRNEKLDRAKQMSER
LVKLHPTNPTYLDTYAWVLYKMGNYTDARKYLEQAVAISDDATVVEHYGDVLFKLGKKEE
AVSQWQKAKLKGEASAYIDKKIKDRKLYE