Protein Info for CA264_14455 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ribosome maturation factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 PF02576: RimP_N" amino acids 3 to 73 (71 residues), 53.4 bits, see alignment E=2.8e-18 PF17384: DUF150_C" amino acids 76 to 147 (72 residues), 43.4 bits, see alignment E=3.2e-15

Best Hits

Swiss-Prot: 38% identical to RIMP_STRGG: Ribosome maturation factor RimP (rimP) from Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350)

KEGG orthology group: K09748, ribosome maturation factor RimP (inferred from 42% identity to mtt:Ftrac_2447)

Predicted SEED Role

"FIG000325: clustered with transcription termination protein NusA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YYJ6 at UniProt or InterPro

Protein Sequence (148 amino acids)

>CA264_14455 ribosome maturation factor (Pontibacter actiniarum KMM 6156, DSM 19842)
MAEASLPESDLFIVDVAVSDSSVRPKITVLADGEQGITIDQCATISRRINKKIEETEGEE
VSYVLEVSSPGTDFPLTQPQQFKRNTGRNLKIKLQDGSEKTGKLEEVTETGLNLMEEVKA
KKGKKATYEPVQIPFGDIVKANVVISFK