Protein Info for CA264_14425 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: acetyl-CoA carboxylase carboxyl transferase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00515: acetyl-CoA carboxylase, carboxyl transferase, beta subunit
  • amino acids 3 to 279 (277 residues), 383.9 bits, E=2.3e-119
• PF01039: Carboxyl_trans
  • amino acids 98 to 244 (147 residues), 78.7 bits, E=2e-26

Best Hits

Swiss-Prot: 73% identical to ACCD_PEDHD: Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD) from Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3)

KEGG orthology group: K01963, acetyl-CoA carboxylase carboxyl transferase subunit beta [EC: 6.4.1.2] (inferred from 75% identity to lby:Lbys_2572)

MetaCyc: 50% identical to acetyl-CoA carboxyltransferase subunit beta (Escherichia coli K-12 substr. MG1655)
RXN0-5055 [EC: 2.1.3.15]

Predicted SEED Role

"Acetyl-coenzyme A carboxyl transferase beta chain (EC 6.4.1.2)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.4.1.2)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (13/16 steps found)
• biotin-carboxyl carrier protein assembly (4/4 steps found)
• fatty acid biosynthesis initiation (type II) (3/3 steps found)
• propanoyl CoA degradation I (3/3 steps found)
• superpathway of fatty acid biosynthesis initiation (4/5 steps found)
• 2-oxobutanoate degradation I (3/4 steps found)
• fatty acid biosynthesis initiation (type I) (1/3 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (11/17 steps found)
• 3-hydroxypropanoate cycle (8/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
• superpathway of L-methionine salvage and degradation (9/16 steps found)
• methylaspartate cycle (11/19 steps found)
• candicidin biosynthesis (1/6 steps found)
• jadomycin biosynthesis (3/9 steps found)
• superpathway of candicidin biosynthesis (4/11 steps found)
• glyoxylate assimilation (5/13 steps found)
• superpathway of the 3-hydroxypropanoate cycle (8/18 steps found)
• superpathway of mycolate biosynthesis (24/239 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis
• Propanoate metabolism
• Pyruvate metabolism
• Tetracycline biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.2

Use Curated BLAST to search for 2.1.3.15 or 6.4.1.2

Sequence Analysis Tools

See A0A1X9YYJ9 at UniProt or InterPro

Protein Sequence (298 amino acids)

>CA264_14425 acetyl-CoA carboxylase carboxyl transferase subunit beta (Pontibacter actiniarum KMM 6156, DSM 19842)
MPWFKRADKGIQTPTEQKKETPDGLWYKCPNCKTVTSMAEHRKNLNTCVQCDYHDRIGSK
EYFAILFDDNDFTELDENLTSGDPLNFVDSKPYPQRIASTQKATGLKDAVRSAYGKINGQ
NITIACMDFAFIGGSMGSVVGEKIARAIDHARKTRTPFLMISKSGGARMMEAGFSLMQMA
KTSAKLALLSEEKLPYISLLTDPTTGGVTASYAMLGDFNIAEPGALIGFAGPRVIKETIG
KDLPKGFQSAEFVLEHGFLDFIVDRKQLKNKLSELLSMVLLPQDITTAPKAKKVAKAS