Protein Info for CA264_14350 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hemolysin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 98 to 121 (24 residues), see Phobius details amino acids 139 to 165 (27 residues), see Phobius details PF01595: CNNM" amino acids 6 to 199 (194 residues), 181 bits, see alignment E=2.8e-57 PF00571: CBS" amino acids 216 to 273 (58 residues), 29.1 bits, see alignment E=1.6e-10 amino acids 282 to 335 (54 residues), 25.1 bits, see alignment 2.8e-09 PF03471: CorC_HlyC" amino acids 351 to 428 (78 residues), 52.4 bits, see alignment E=6.3e-18

Best Hits

KEGG orthology group: None (inferred from 55% identity to psn:Pedsa_2944)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YUD1 at UniProt or InterPro

Protein Sequence (437 amino acids)

>CA264_14350 hemolysin (Pontibacter actiniarum KMM 6156, DSM 19842)
MVLDILLTIFLVLLNGFFVAAEFAIVKVRSSQIELRAQSGNTMAKLAQNMLTHLDAYLSA
TQLGITLASLGLGWIGESVVARMVINVMEAFGFRGGEALAHTIALPVSFAIITVLHIVFG
ELAPKSLAIQRSESTALAVAYPLRFFYVLFKPFIWLLNGLANLVLRGLGIQPMHGAEVHT
AEELRLLFEQSVEGGAIQDSHHELIENVFHFNERMVKQILVPRTKMVAIDVNIPEEELME
IIFNEGYSRLPVYTGNVDNIVGILYVKDILSIMRLGQPIVIDDLMRPAYFVPETKKINLL
LKQFQRRHLHMAIATDEFGGVSGIVTIEDIIEELVGEIQDEYDEEVPLVERISDFEYKVS
GSAAISDANDYLPYPLPEGEDYETVGGLLNVIYGQIPENLNETTTFNQYDVRILEKSERR
VESVLLTVREEDRDEIS