Protein Info for CA264_14325 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: superoxide dismutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00081: Sod_Fe_N
  • amino acids 3 to 85 (83 residues), 114 bits, E=3.7e-37
• PF02777: Sod_Fe_C
  • amino acids 92 to 197 (106 residues), 147.3 bits, E=1.3e-47

Best Hits

Swiss-Prot: 71% identical to SODM_BACSU: Superoxide dismutase [Mn] (sodA) from Bacillus subtilis (strain 168)

KEGG orthology group: K04564, superoxide dismutase, Fe-Mn family [EC: 1.15.1.1] (inferred from 78% identity to fbc:FB2170_06535)

MetaCyc: 55% identical to superoxide dismutase (Mn) (Escherichia coli K-12 substr. MG1655)
Superoxide dismutase. [EC: 1.15.1.1]

Predicted SEED Role

"Manganese superoxide dismutase (EC 1.15.1.1)" in subsystem Nitric oxide synthase or Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

• reactive oxygen species degradation (4/4 steps found)
• ethene biosynthesis III (microbes) (6/7 steps found)
• superoxide radicals degradation (2/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.15.1.1

Sequence Analysis Tools

See A0A1X9YUJ5 at UniProt or InterPro

Protein Sequence (202 amino acids)

>CA264_14325 superoxide dismutase (Pontibacter actiniarum KMM 6156, DSM 19842)
MAFELPKLPYAYDALEPHIDARTMEIHHTKHHQAYTTNLNNAIQGTELEGKSIEEIMRSV
KEDNKAVRNNGGGYYNHNLFWTILSPNGGGQPSGELADAINSAFGSFDQFKEKFNAAAAT
RFGSGWAWLCVKDGKLEICSTPNQDNNLMPFAEGCGGQPILGLDVWEHAYYLNYQNRRPD
YINAFWNVVNWEEVTRRYNEAK