Protein Info for CA264_14240 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: NADH-quinone oxidoreductase subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 TIGR01971: NADH-quinone oxidoreductase, chain I" amino acids 15 to 144 (130 residues), 126.4 bits, see alignment E=2.2e-41 PF13534: Fer4_17" amino acids 32 to 72 (41 residues), 23.2 bits, see alignment E=4.2e-08 PF13237: Fer4_10" amino acids 56 to 116 (61 residues), 32.4 bits, see alignment E=3.6e-11 PF13183: Fer4_8" amino acids 56 to 117 (62 residues), 29.8 bits, see alignment E=3.6e-10 PF12800: Fer4_4" amino acids 57 to 71 (15 residues), 18.5 bits, see alignment (E = 1e-06) amino acids 104 to 117 (14 residues), 13.2 bits, see alignment (E = 5.2e-05) PF00037: Fer4" amino acids 57 to 75 (19 residues), 27 bits, see alignment (E = 1.5e-09) amino acids 99 to 120 (22 residues), 31.9 bits, see alignment 4.1e-11 PF13187: Fer4_9" amino acids 58 to 120 (63 residues), 37.4 bits, see alignment E=1.1e-12 PF13484: Fer4_16" amino acids 58 to 117 (60 residues), 32.2 bits, see alignment E=7.8e-11 PF12838: Fer4_7" amino acids 58 to 119 (62 residues), 46.1 bits, see alignment E=2.8e-15

Best Hits

Swiss-Prot: 67% identical to NUOI_CYTH3: NADH-quinone oxidoreductase subunit I (nuoI) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K00338, NADH dehydrogenase I subunit I [EC: 1.6.5.3] (inferred from 74% identity to fte:Fluta_1965)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain I (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YY90 at UniProt or InterPro

Protein Sequence (154 amino acids)

>CA264_14240 NADH-quinone oxidoreductase subunit I (Pontibacter actiniarum KMM 6156, DSM 19842)
MTFAEKAYLPAIAQGLGITLKHFFKKKATIQYPEQTRERSEHWRGLHVLKRDEKGAERCT
ACGLCAVACPAEAITMTAGERKAGEEHLYREEKYAVTYEVNMLRCIFCGLCEEACPKAAI
FLQDDKIAPARFERDEFIYGKDRLVEPLKTTETK