Protein Info for CA264_14225 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: NADH oxidoreductase (quinone) subunit F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 TIGR01959: NADH oxidoreductase (quinone), F subunit" amino acids 6 to 426 (421 residues), 597.7 bits, see alignment E=3.9e-184 PF01512: Complex1_51K" amino acids 46 to 217 (172 residues), 162.2 bits, see alignment E=8.9e-52 PF10589: NADH_4Fe-4S" amino acids 343 to 425 (83 residues), 113.4 bits, see alignment E=3.6e-37

Best Hits

Swiss-Prot: 50% identical to NQO1_THET8: NADH-quinone oxidoreductase subunit 1 (nqo1) from Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)

KEGG orthology group: K00335, NADH dehydrogenase I subunit F [EC: 1.6.5.3] (inferred from 80% identity to sli:Slin_5103)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain F (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YUD6 at UniProt or InterPro

Protein Sequence (448 amino acids)

>CA264_14225 NADH oxidoreductase (quinone) subunit F (Pontibacter actiniarum KMM 6156, DSM 19842)
MGLKILTEHINVPGIETLEVYRKHGGYKSVEKALKTMSPEEVVEEVKTSGLRGRGGAGFP
TGMKWSFLAKPEGVPRYLVCNADESEPGTFKDRWFMEKNPHALIEGMITSSYALGANTSY
IYIRGELLFVLRILEKAIAEAYAAGLLGKNILGSGYDLDLHVAPGGGAYICGEETALLES
LEGKRGNPRNKPPFPAVKGLFQSPTVVNNVETISSVPWIVNNTGAEYAKIGIGRSTGTKL
ISASGNINKPGVYEIELGVPVEEFIYSDEYCGGIWKGKQLKAVVPGGSSVPILPAELILK
TAAGEQRLMSYESLSDGGFVSGSMLGSGAFIVFDEDQCIVRNTWNYARFYHHESCGQCSP
CREGTGWMEKVLHRIEYGHGHQQDIDLLVSVAKQIEGNTICPLGDAAAWPVAAAIRHFRH
EFEWHINHPKEATAPGAVYRGQLDAVTA