Protein Info for CA264_14200 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: NADH-quinone oxidoreductase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00507: Oxidored_q4
  • amino acids 28 to 125 (98 residues), 112.3 bits, E=5.6e-37

Best Hits

Swiss-Prot: 56% identical to NUOA_FLAPJ: NADH-quinone oxidoreductase subunit A (nuoA) from Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511)

KEGG orthology group: K00330, NADH dehydrogenase I subunit A [EC: 1.6.5.3] (inferred from 64% identity to dfe:Dfer_4088)

MetaCyc: 37% identical to ferredoxin-quinone oxidoreductase subunit C (Parasynechococcus marenigrum WH 8102)

Predicted SEED Role

"NADH ubiquinone oxidoreductase chain A (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• Fe(II) oxidation (2/6 steps found)
• NAD(P)/NADPH interconversion (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

See A0A1X9YUH9 at UniProt or InterPro

Protein Sequence (126 amino acids)

>CA264_14200 NADH-quinone oxidoreductase subunit A (Pontibacter actiniarum KMM 6156, DSM 19842)
MESAVHQYIPSDYLPILIQFAAALGFVIFALTLTHLLGPKRNSEVKGAAWESGIESVGDA
RTPISYKYFMTAILFVLFDVEIIFMYPWAVNFKGFGLEGFLQMLVFVTLLMAGFFYVIKK
GILDWE