Protein Info for CA264_14160 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: HupE / UreJ protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 44 to 66 (23 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 175 to 192 (18 residues), see Phobius details PF13795: HupE_UreJ_2" amino acids 8 to 164 (157 residues), 158.3 bits, see alignment E=6.5e-51

Best Hits

KEGG orthology group: None (inferred from 40% identity to gfo:GFO_3485)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YUL8 at UniProt or InterPro

Protein Sequence (197 amino acids)

>CA264_14160 HupE / UreJ protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MSSVFSTYIELGFHHIFDFKAYDHMLFLLALSAIYTLQDWRKVIALVTSFTIGHSITLAL
ATFKIIQFDTALIEFLIPVTILLTCVTNFFKLKGAAAKQPTIFSLHNLMAVFFGLIHGMG
FSNFLRQMLGRNGNIWQQLLAFNIGIELGQLLIVGIILVLGFLAMHLFRAKKRDWIMVLS
SAAAGISLILMMETSIF