Protein Info for CA264_14125 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: endonuclease V

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 50% identical to NFI_DICTD: Endonuclease V (nfi) from Dictyoglomus turgidum (strain Z-1310 / DSM 6724)

KEGG orthology group: K05982, deoxyribonuclease V [EC: 3.1.21.7] (inferred from 50% identity to tam:Theam_0816)

MetaCyc: 49% identical to endonuclease V (Escherichia coli K-12 substr. MG1655)
Deoxyribonuclease V. [EC: 3.1.21.7]

Predicted SEED Role

"Endonuclease V (EC 3.1.21.7)" in subsystem DNA repair, bacterial (EC 3.1.21.7)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YUD2 at UniProt or InterPro

Protein Sequence (227 amino acids)

>CA264_14125 endonuclease V (Pontibacter actiniarum KMM 6156, DSM 19842)
MAYYRRFDAPPPDPKVLQALTEQQRQMQERIILQKPDFELKLIAGCDSSFIGEDTILSAF
ILLTYPELEVVEKVWHHGPVELPYIPGFLSFREAPNLLKAYEKLQQQPDLIMVDGHGISH
PRRLGIATHLGLQLNKPTMGVAKKVLVGKYKEPGTAKGAVAPLEHKGEVVANVLRTKDNI
KPVFVSPGHLMDLQSATEIALNCATKYKLPEPTRLADHYAAVFKKDV