Protein Info for CA264_14065 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: cyclopropane-fatty-acyl-phospholipid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 PF02353: CMAS" amino acids 99 to 358 (260 residues), 289.1 bits, see alignment E=1.4e-89 PF01728: FtsJ" amino acids 145 to 194 (50 residues), 30.1 bits, see alignment 1.8e-10 PF05175: MTS" amino acids 149 to 254 (106 residues), 24.1 bits, see alignment E=9.9e-09 PF13489: Methyltransf_23" amino acids 155 to 277 (123 residues), 50.8 bits, see alignment E=6.3e-17 PF13847: Methyltransf_31" amino acids 157 to 259 (103 residues), 44.2 bits, see alignment E=6.8e-15 PF13649: Methyltransf_25" amino acids 161 to 251 (91 residues), 62.3 bits, see alignment E=2.3e-20 PF08242: Methyltransf_12" amino acids 162 to 253 (92 residues), 46.4 bits, see alignment E=2.2e-15 PF08241: Methyltransf_11" amino acids 162 to 254 (93 residues), 57.7 bits, see alignment E=6.2e-19

Best Hits

Swiss-Prot: 52% identical to CFA_ECOL6: Cyclopropane-fatty-acyl-phospholipid synthase (cfa) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 60% identity to dao:Desac_1801)

MetaCyc: 52% identical to cyclopropane fatty acyl phospholipid synthase (Escherichia coli K-12 substr. MG1655)
Cyclopropane-fatty-acyl-phospholipid synthase. [EC: 2.1.1.79]

Predicted SEED Role

"Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79)" (EC 2.1.1.79)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YUC2 at UniProt or InterPro

Protein Sequence (373 amino acids)

>CA264_14065 cyclopropane-fatty-acyl-phospholipid synthase (Pontibacter actiniarum KMM 6156, DSM 19842)
MGTPGLQQSVAKVLAAADVKINGPDPWDLQVHDTRFYKRVLTQGTLGLGESYMDGWWDCE
RIDAFIFRALRANLYQQAAFGWKAVLQTLLARLLNMQAKGKAVRNAQRHYDIGNNLYQLM
LDKRMTYSCGYWKGADTLDQAQENKLDLICRKIRLQPGQRVLDIGCGWGSFAKFAAEKYG
AEVVGVTVSKEQVELGRQLCKGLPVELRLQDYRDVNEQFDHVVSVGMAEHVGYKNHRTYL
ETAARCLKDNGLFLLHTIGVNYSRTSADPFTNTYIFPNCLIPSVKQLGAAMEHVFVAEDW
HNFGPDYDPTLLAWFQNFDTSWGQLQGSYGERFYRMWKYYLLSSAGSFRARHNQLWQIVL
SRQGIPGGYEPVR