Protein Info for CA264_14055 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: sigma-54-dependent Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 PF00072: Response_reg" amino acids 9 to 123 (115 residues), 71.2 bits, see alignment E=2.8e-23 PF00158: Sigma54_activat" amino acids 148 to 314 (167 residues), 217.3 bits, see alignment E=3.8e-68 PF14532: Sigma54_activ_2" amino acids 149 to 319 (171 residues), 77.2 bits, see alignment E=5.1e-25 PF07724: AAA_2" amino acids 169 to 271 (103 residues), 30.2 bits, see alignment E=1.6e-10 PF07728: AAA_5" amino acids 171 to 292 (122 residues), 39.4 bits, see alignment E=2.1e-13 PF00004: AAA" amino acids 172 to 291 (120 residues), 27.8 bits, see alignment E=1.1e-09 PF02954: HTH_8" amino acids 413 to 452 (40 residues), 51.3 bits, see alignment 2.8e-17

Best Hits

KEGG orthology group: None (inferred from 61% identity to rbi:RB2501_00511)

Predicted SEED Role

"Two-component system response regulator" in subsystem Streptococcal Mga Regulon or Two-component regulatory systems in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YUB2 at UniProt or InterPro

Protein Sequence (455 amino acids)

>CA264_14055 sigma-54-dependent Fis family transcriptional regulator (Pontibacter actiniarum KMM 6156, DSM 19842)
MATVRNARVLVVDDETDVLFALKMLLKTEVKEVVTEKNPENLLGLLERQKFDAILLDMNF
KSALNTGNEGLFWLRQILERDKGASVILITAYGDVELAVKSLKEGAADFIVKPWHNDKLL
ETLHHTLDRRQQKPRTAAAPPKNTSTSILGESDAIKEVLYKIEKIAPTEANVLILGENGT
GKELVARALHEKSFRAANPFVSVDMGALTDSLFESELFGSKKGAFTDAREDRAGRFETAN
GGTLFLDEIGNISPAMQAKLLTVLQNRQVTPLGSNTPVPVDIRLISATNEPIYELAARNQ
FRKDLIYRINTVEIMLPPLRQRHGDVELLARHFAAVYAQKNHKPVPEFAAATLQKLKQHS
WPGNVRELQHAVERAIILAESHTLQPQDFSFSPVEMAPAAPAAAYTPETPVPLSEIERET
IVRALEKNKGNISRTAKELGLTRTALYRRLNKHDI