Protein Info for CA264_14005 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: D-xylose transporter XylE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 47 to 67 (21 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 246 to 272 (27 residues), see Phobius details amino acids 287 to 309 (23 residues), see Phobius details amino acids 317 to 338 (22 residues), see Phobius details amino acids 344 to 368 (25 residues), see Phobius details amino acids 380 to 399 (20 residues), see Phobius details amino acids 418 to 436 (19 residues), see Phobius details TIGR00879: MFS transporter, sugar porter (SP) family" amino acids 2 to 446 (445 residues), 461.4 bits, see alignment E=1.8e-142 PF00083: Sugar_tr" amino acids 10 to 451 (442 residues), 434.3 bits, see alignment E=5.9e-134 PF07690: MFS_1" amino acids 15 to 393 (379 residues), 109.7 bits, see alignment E=1.6e-35 amino acids 255 to 452 (198 residues), 44.5 bits, see alignment E=1e-15

Best Hits

Predicted SEED Role

"D-xylose proton-symporter XylE" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YYA1 at UniProt or InterPro

Protein Sequence (470 amino acids)

>CA264_14005 D-xylose transporter XylE (Pontibacter actiniarum KMM 6156, DSM 19842)
MNLPYIVGITLAATLGGLLFGYDTAVISGAIGSLRTYFDLNDVQEGWAASSALVGCIGGA
AIAGWLADRFGRKPGLLAAALLFTISAIGSAIPDTFTEFIVYRIIGGVGVGIASMLSPMY
IAEIAPEHLRGRLVSLNQFAIVFGMLVVYFVNYGIAMQGDAAWNVETGWRWMFGSETIPA
ALFFLLLLFVPQSPRWLMLVGREQQADTVLSRIMNPGYAKKALAEIKHSLHQDRALPKVR
IIGQGFGWVVFIGIMLSVFQQITGINVILYYAPRIFSQLGGGTTDTALLQTIVVGAVNLV
FTVIAILTVDRLGRKPLMIYGSLGMGICITAVGTTAYLQITDSWILIFMLGYIASFALSL
GPVVWVLLSEIFPNQIRGRAMAIAVAAQWISNFAVSQTFPMMMGNSFLMDNFHGGFPFWL
YGAMCVVTILFVWKFVPETKGRKLEDMEALWRKKSELVPEEPALAGQSNV