Protein Info for CA264_13975 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: LacI family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 PF00356: LacI" amino acids 6 to 51 (46 residues), 42.3 bits, see alignment 1e-14 PF00532: Peripla_BP_1" amino acids 63 to 312 (250 residues), 83.8 bits, see alignment E=3.1e-27 PF13407: Peripla_BP_4" amino acids 65 to 314 (250 residues), 99.4 bits, see alignment E=5.2e-32 PF13377: Peripla_BP_3" amino acids 174 to 336 (163 residues), 108.8 bits, see alignment E=6.7e-35

Best Hits

Swiss-Prot: 33% identical to CCPA_BACME: Catabolite control protein A (ccpA) from Bacillus megaterium

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 61% identity to sli:Slin_0352)

Predicted SEED Role

"LacI family transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YUI8 at UniProt or InterPro

Protein Sequence (347 amino acids)

>CA264_13975 LacI family transcriptional regulator (Pontibacter actiniarum KMM 6156, DSM 19842)
MEKEVTIYDIAKELSISPTTVSRGLNNHPAVNKNTKQKIIDVASQMGYRSNTFASKLRKQ
RTNTIGVIVPRLDSNFQSCVMAGMEKVANEAGYNLIISQSLETVQKEIANARTMFDNRVD
GLLVSIAYDTENIDHFEPFFSKGIPVLFYDRVPEHKKCTSIVIDNIQAAYKATAHLVEQG
CSNIVHISGNLKVNVYKDRLKGFKYALMDSDLPFSESSVITTNLNEEAGIQAAKQILQMN
PRPDGIFVANDNCAVSCVKTLKQAGVRIPEDIAVVGFNNDPITRVIEPNLTSVDYPGNEM
GEVAVRSLINYLDGMSDVSLTNTITLRSELVVRESTTRTGATGAVAP