Protein Info for CA264_13945 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 54 to 76 (23 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details amino acids 277 to 298 (22 residues), see Phobius details amino acids 310 to 327 (18 residues), see Phobius details amino acids 333 to 356 (24 residues), see Phobius details amino acids 368 to 391 (24 residues), see Phobius details amino acids 403 to 425 (23 residues), see Phobius details PF07690: MFS_1" amino acids 22 to 384 (363 residues), 203.7 bits, see alignment E=4.1e-64 PF00083: Sugar_tr" amino acids 45 to 411 (367 residues), 28.1 bits, see alignment E=9.9e-11

Best Hits

KEGG orthology group: K08191, MFS transporter, ACS family, hexuronate transporter (inferred from 66% identity to phe:Phep_1023)

Predicted SEED Role

"Hexuronate transporter" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YU96 at UniProt or InterPro

Protein Sequence (434 amino acids)

>CA264_13945 MFS transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MSKPTTERVKIGSYRWTICALVFFATTINYLDRQVVGILKPVLEEQFNWTESDYGAIVTA
FTASYALGMVVFGRIIDKVGTKAGYSLSIIVWSLAAMAHAVARSTFGFAVARGALGVGES
GNFPAAVKTVAEWFPKKERALATGLFNCGANVGAIAAPILVPWIVVTYGWEEAFIATGAI
GFVWLVFWFIFYEVPAKQKRLGKGEYDYIHSDNDEAPAEENQRPLKWSRLLFIRQTWVFV
CGKFFTDPIWYFFLFWLPSYFSSTFDLNLSSLGLPLAIVYTATTIGSIGGGYLSSYFIRK
GWPVFKARKTAMLIIALLVVPIMLARYTSDMWVAVGLISMAAAAHQAWSANIYTIVSDMF
PKRAVSSVVGIGGMAGSLSGALFPLFIGFVLDYYKVLGNLTAGYNIIFLICGSAYLVAWL
VIHFLSPKMKPVAL