Protein Info for CA264_13925 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: cytochrome c oxidase subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 606 transmembrane" amino acids 42 to 63 (22 residues), see Phobius details amino acids 91 to 120 (30 residues), see Phobius details amino acids 134 to 156 (23 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 227 to 253 (27 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details amino acids 321 to 342 (22 residues), see Phobius details amino acids 351 to 376 (26 residues), see Phobius details amino acids 388 to 409 (22 residues), see Phobius details amino acids 422 to 448 (27 residues), see Phobius details amino acids 460 to 483 (24 residues), see Phobius details amino acids 508 to 530 (23 residues), see Phobius details PF00115: COX1" amino acids 38 to 516 (479 residues), 486.4 bits, see alignment E=4.2e-150

Best Hits

KEGG orthology group: K02274, cytochrome c oxidase subunit I [EC: 1.9.3.1] (inferred from 75% identity to chu:CHU_2206)

Predicted SEED Role

"Cytochrome c oxidase polypeptide I (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YU77 at UniProt or InterPro

Protein Sequence (606 amino acids)

>CA264_13925 cytochrome c oxidase subunit I (Pontibacter actiniarum KMM 6156, DSM 19842)
MASTDITRPGVAHEEHEEHHHDQNFFEKYIFSQDHKTISRQYLFTGMAWAFIGSFLSILF
RLQLGWPEATFTFLEPILGNWIENGKLNPEFYLALVTMHGTIMVFFVLTAGLSGTFSNFL
IPLQIGARDMASGFMNMLSFWIFFLSSIILFASLFIDTGPAAGGWTVYPPLSALPQAIQG
SMSGMTMWLIAMALFIVSQLLGGVNYITTVINLRTEGMAMSKLPLTIWAFFFTAILGLLA
FPVLFSAALLLIFDRSFGTSFFLSDIYIAGEALTNTGGSPILFQHLFWFLGHPEVYIVIL
PAFGIVSEVIATNARKPIFGYRAMIGSMIGISVLSFVVWAHHMFVTGMNPFLGSVFMFLT
LIIAVPSAVKVFNWLATLWRGNIRFTTAMMFAIGFVSLFISGGLTGIILGNSSLDIQLHD
TYFVVAHFHLVMGAAAFFGMFAGVYHWFPKMFGRMMDEKLGYVHFWLTFAASYLVFMPMH
YMGIAGFPRRYYNWTGFETFNIFTDMNTFVSIAAIMAFVAQFIFLFNFIYSIFRGRRATA
NPWHSNTLEWTTPVLPGHGNWPGKIPVVYRWPYDYSKPGAVEDYIPQHVPFSQTTSSNMP
RERELE