Protein Info for CA264_13915 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: PAS domain-containing sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 TIGR00229: PAS domain S-box protein" amino acids 15 to 139 (125 residues), 112.2 bits, see alignment E=8.9e-37 amino acids 140 to 267 (128 residues), 95.7 bits, see alignment E=1.1e-31 PF13188: PAS_8" amino acids 17 to 69 (53 residues), 37.1 bits, see alignment 6.4e-13 PF00989: PAS" amino acids 17 to 129 (113 residues), 57.6 bits, see alignment E=3.7e-19 amino acids 147 to 257 (111 residues), 57 bits, see alignment E=5.5e-19 PF08448: PAS_4" amino acids 25 to 88 (64 residues), 41.8 bits, see alignment E=3.5e-14 amino acids 154 to 216 (63 residues), 27 bits, see alignment E=1.3e-09 PF13426: PAS_9" amino acids 27 to 131 (105 residues), 63 bits, see alignment E=8.6e-21 amino acids 155 to 259 (105 residues), 43.7 bits, see alignment E=8.5e-15 PF00512: HisKA" amino acids 281 to 347 (67 residues), 49.1 bits, see alignment E=1.5e-16 PF02518: HATPase_c" amino acids 390 to 509 (120 residues), 87.9 bits, see alignment E=1.9e-28

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YUH6 at UniProt or InterPro

Protein Sequence (514 amino acids)

>CA264_13915 PAS domain-containing sensor histidine kinase (Pontibacter actiniarum KMM 6156, DSM 19842)
MEDSLQNRYRNVDDQSRLKAIIETAVDGIITIDTEGRMESANPAAARIFGYEPEEMIGRN
VHMLMPEPDHGLHDGYIKRYMQTGEGQIIGKGREVLGKKKDGSLFPFFLSIAEVKLQDKI
IFTGIVHDISDLKKTEEALRESESKINSIIQTAVDGIITIDRRGVMEMVNPAAARLFEYE
EHELIGRKINMLMPEPDQSLHDNYMHHYHETGERRIIGIGREVSGLKKSGTIFPLYLSIS
EVQLTDRKVYTGFIHDITQQKLSEERLRRYAAELERSNRELQDFAYVSSHDLQEPLRKIQ
AFGDRLKTKEYEKLSDQGKDYVDRMLNAASRMQNLINDLLDFSRVTSKSKAFVQVSLDSV
LTDVLSDLEITIEKTGAQIQRAPLPHIEADPTQLRQLFQNLVSNAIKFRKENEQPQINIF
ARELQGKARMTSTPGDEMVEIHVQDNGIGFDEKYLDRIFNIFQRLEGQKYEGSGIGLAIC
RKIAVRHGGDITAHSQAGIGTTFIVTLAKRHLQD