Protein Info for CA264_13810 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 103 to 134 (32 residues), see Phobius details amino acids 139 to 158 (20 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 207 to 230 (24 residues), see Phobius details amino acids 265 to 289 (25 residues), see Phobius details amino acids 321 to 340 (20 residues), see Phobius details amino acids 401 to 418 (18 residues), see Phobius details amino acids 424 to 447 (24 residues), see Phobius details amino acids 459 to 481 (23 residues), see Phobius details PF01566: Nramp" amino acids 53 to 333 (281 residues), 56.1 bits, see alignment E=1.7e-19

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YUF7 at UniProt or InterPro

Protein Sequence (484 amino acids)

>CA264_13810 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MKTKDAEKDEKKEIRASTPAPPKGKDRWKWYGPGLIWMLSSVGSGSVLFTPRIGSRYEYS
LLWVALVVFILMWVMIREVGRYTVVTGKSILDGFHDLSGSSGWAIWLIFVPQLVAAVVTI
AGIAALAGSALMIALPGSQLLYAISLIVFSIVLVVSGRYRWVERATNALAALLVLIVVVT
AVKVIPSGQALLSGAVPSIPQNFDIQFVLPWVGFILAGAAGIMWFSYWVVAREYGGPQAS
PEDVEHIPEDTGEEQERAGRLKEWFRIMGTTAAIGVAGGGLIIVAFMTLGAELLAPKGIV
PQGIQVAEDLTRLLSEVWGRAGFWLLITAIVIALGGTVLANQDGWGRMFADASLILLAPW
FRKTDKVAYNNRRDIHPSDKANGKEKRLYDLVTKRRQLKNAYAIVFCAAIPVALLFIVQD
PVAILSIGGAVATAHTPIVVFLTLYLNHQRLPKALAPGFFTNFMMVVAGIFYLGFALFYF
ISKV