Protein Info for CA264_13775 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 39 to 57 (19 residues), see Phobius details amino acids 69 to 92 (24 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 195 to 215 (21 residues), see Phobius details amino acids 244 to 261 (18 residues), see Phobius details amino acids 282 to 299 (18 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details amino acids 403 to 424 (22 residues), see Phobius details amino acids 465 to 487 (23 residues), see Phobius details PF02386: TrkH" amino acids 112 to 286 (175 residues), 100.8 bits, see alignment E=3.3e-33 amino acids 303 to 480 (178 residues), 96.8 bits, see alignment E=5.8e-32

Best Hits

Predicted SEED Role

"Potassium uptake protein TrkH" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YU53 at UniProt or InterPro

Protein Sequence (495 amino acids)

>CA264_13775 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MSVNFKAFLKDVGKLLYLPAVFAFVTLPVIIYFKEWFALPPFALMAVVSFGVGQLLFQPV
KSSQESAAGLSIIFVTVAWLLLPLFGIIAFYGTALAAPENTYPAVSVFLQPTNCFFESMS
GFTGTGLTMVKNPSQLPYTLQWGRSFMEWIGGVGVIMLASMLLSFNHDKGKLYHAETRKW
TIDDAPATATIKKIWWIYVAYTVASILTFYLAGMPFWEALNHGMTAIGTGGFSVTPRSFT
DYSSLIKALAVVIMVVGAINFKAHYLLIFRRDIKSVLKQTQLRYFAALLVVALLTMVLIK
PDTPFIDILFQVASALGTCGLNTAKLSTWAMAPLFLLVVLMLFGGNAGSTAGGIKTERVA
WFTKGIWRGAKKAWLPEDEEPPLYFDQEAKKPKVTDRNIEQAAVIYFIWMATLTVGTLCL
SVLVGDQYTFDQVVFDSASALSNVGLSSGLTGPDLPNSAKLLLTGLMWVGRLEVMAVVIL
LLSPLYIAKSHHPNT