Protein Info for CA264_13770 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: DNA starvation/stationary phase protection protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 PF00210: Ferritin" amino acids 19 to 156 (138 residues), 73.1 bits, see alignment E=1.1e-24

Best Hits

Swiss-Prot: 51% identical to Y1349_HAEIN: Uncharacterized protein HI_1349 (HI_1349) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K04047, starvation-inducible DNA-binding protein (inferred from 52% identity to csa:Csal_2953)

Predicted SEED Role

"Non-specific DNA-binding protein Dps / Iron-binding ferritin-like antioxidant protein / Ferroxidase (EC 1.16.3.1)" in subsystem Oxidative stress (EC 1.16.3.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.16.3.1

Use Curated BLAST to search for 1.16.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YU34 at UniProt or InterPro

Protein Sequence (157 amino acids)

>CA264_13770 DNA starvation/stationary phase protection protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MEKLSNIGLQKEDSRHVAEKLNELLANYHLYYQNLRGFHWNIKGIHFFQLHDKFEELYGS
ALSRIDAIAERILTIGQQPLHTFSDYMRLSSIKEAANLSGDKETVSATHQNLSILLDLER
EILKLAAETGDEGTVSLISEDIHENEKTLWMLNAFLS