Protein Info for CA264_13735 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 TIGR00216: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase" amino acids 3 to 291 (289 residues), 221.5 bits, see alignment E=6.6e-70 PF02401: LYTB" amino acids 3 to 289 (287 residues), 264.4 bits, see alignment E=5.3e-83

Best Hits

Swiss-Prot: 71% identical to ISPH_CYTH3: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (ispH) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K03527, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [EC: 1.17.1.2] (inferred from 71% identity to chu:CHU_0087)

Predicted SEED Role

"4-hydroxy-3-methylbut-2-enyl diphosphate reductase (EC 1.17.1.2)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 1.17.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.2

Use Curated BLAST to search for 1.17.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YU63 at UniProt or InterPro

Protein Sequence (297 amino acids)

>CA264_13735 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (Pontibacter actiniarum KMM 6156, DSM 19842)
MNVTIDKNSGYCFGVEFAIQMAEDEMEGCEELYCLGDIVHNSMEVKRLYEKGLRIIDREQ
LQELRDCKVLIRAHGEPPETYKLALENNIELIDASCPVVLKLQNRVKHAFDKGLPDNAQV
VIYGQVGHAEVIGLAGQTRDEAIIVTTEEDLDKIDFTRPVTLFSQTTKSTKGFYHIKSLI
EERLQQANQDSTAVPEFDANDSICRQVSNREPQLARFSTEHDVIVFVSGKKSSNGKALYS
VCKQHNPSSYFVESEEELQEEWFTNASSVGVCGATSTPMWLMEQVATSITAFEAEQV