Protein Info for CA264_13625 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 PF13302: Acetyltransf_3" amino acids 35 to 141 (107 residues), 34.4 bits, see alignment E=8.6e-12 PF00583: Acetyltransf_1" amino acids 44 to 140 (97 residues), 57.1 bits, see alignment E=5.3e-19 PF13673: Acetyltransf_10" amino acids 47 to 144 (98 residues), 26.1 bits, see alignment E=1.8e-09 PF13420: Acetyltransf_4" amino acids 54 to 159 (106 residues), 34.9 bits, see alignment E=3.8e-12 PF13508: Acetyltransf_7" amino acids 57 to 141 (85 residues), 41.1 bits, see alignment E=4.9e-14

Best Hits

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 58% identity to dfe:Dfer_1930)

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.183

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTZ2 at UniProt or InterPro

Protein Sequence (171 amino acids)

>CA264_13625 N-acetyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MQTTTNSLVTVSEMLPEHYPQVQDIYAHGIATHNATLETTAPGWEEWDNKHMKSCRFVAL
TEAGAVAGWAALTPVSGRCVYRGVAEDSVYIHPAHKGQGLGKLLLQRLVEASEREGVWTL
QAGILKENQASIKLHGQCGFRVVGIRERLGQLHGQWRDVCLMERRSNITGL