Protein Info for CA264_13610 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: sodium:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 30 to 50 (21 residues), see Phobius details amino acids 70 to 87 (18 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 128 to 151 (24 residues), see Phobius details amino acids 171 to 188 (18 residues), see Phobius details amino acids 208 to 225 (18 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details amino acids 259 to 268 (10 residues), see Phobius details amino acids 293 to 311 (19 residues), see Phobius details amino acids 317 to 341 (25 residues), see Phobius details amino acids 350 to 374 (25 residues), see Phobius details amino acids 383 to 406 (24 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 10 to 406 (397 residues), 231 bits, see alignment E=1e-72

Best Hits

KEGG orthology group: K03316, monovalent cation:H+ antiporter, CPA1 family (inferred from 47% identity to lby:Lbys_1446)

Predicted SEED Role

"Na+/H+ antiporter NhaP"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YU25 at UniProt or InterPro

Protein Sequence (415 amino acids)

>CA264_13610 sodium:proton antiporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MELFHLFSAILAISALFAYINQKFIKLPGAIGLLLAGLLLSLVVQGLGAVSPEFEAIVEK
RLSELDFSEFLLEFLLSFLLFAGALHTDLERLRESKWPIMVFATVGVLISTAVTGTLFYY
LLQLLNYPIDYIYCLLFGALISPTDPIAVLGILKRAKIPKSLEVSITGESLFNDGVGVVI
FISIFQIAQRGLGNVEGGFIAELFLKEVGGGIGLGLLIGYIAYHFMRRIDHYQTEVLISL
AVVMGGYSLAQIFHFSGPLAMVAAGLLIGNQGTQFAMSKQTADYLTKFWEMVDEIFNAVL
FVLIGLELMVVQFKWEYAVTGVITTGIVLLVRYIALAVPSYTLGLHRTFAPGALSIMTWG
GLRGGISIALALSLTPDMYRNEIVAITYTVVLLSLVVQGLTIESFIKRVSDRVRV